FGF21 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGF21

Key Reference: Chen,W.W., (2008) Exp. Clin. Endocrinol. Diabetes 116 (1), 65-68

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 21

Protein Size: 209

Purification: Affinity Purified

• Artikelnummer: AVIARP55368_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55368_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 26291
• Wirt: Rabbit