English
FLJ37543 Antibody - middle region : Biotin
FLJ37543 Antibody - middle region : Biotin
Artikelnummer
AVIARP55684_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The specific function of the protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ37543
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 15kDa
Peptide Sequence: Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Uncharacterized protein C5orf64
Protein Size: 130
Purification: Affinity Purified
Description of Target: The specific function of the protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ37543
Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Molecular Weight: 15kDa
Peptide Sequence: Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Uncharacterized protein C5orf64
Protein Size: 130
Purification: Affinity Purified
| Artikelnummer | AVIARP55684_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55684_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 285668 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
