FN3KRP Antibody - N-terminal region : Biotin

FN3KRP Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58624_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FN3KRP

Key Reference: Szwergold,B., (2007) Biochem. Biophys. Res. Commun. 361 (4), 870-875

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ketosamine-3-kinase

Protein Size: 309

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58624_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58624_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79672
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×