FOXN3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: FOXN3 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXN3

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Forkhead box protein N3

Protein Size: 468

Purification: Affinity Purified

• Artikelnummer: AVIARP57855_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57855_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1112
• Wirt: Rabbit