GABARAP Antibody - C-terminal region : Biotin

GABARAP Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58902_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: IHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-aminobutyric acid receptor-associated protein

Protein Size: 117

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58902_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58902_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11337
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×