GABARAPL1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1

Key Reference: Tanida,I., (2006) FEBS J. 273 (11), 2553-2562

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 117

Purification: Affinity Purified

• Artikelnummer: AVIARP55398_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55398_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 23710
• Wirt: Rabbit