GAN Antibody - middle region : FITC

GAN Antibody - middle region : FITC
Artikelnummer
AVIARP58470_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAN

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gigaxonin

Protein Size: 597

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58470_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58470_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8139
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×