GFOD1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GFOD1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose-fructose oxidoreductase domain-containing protein 1

Protein Size: 390

Purification: Affinity Purified

• Artikelnummer: AVIARP57304_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57304_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54438
• Wirt: Rabbit