GIMAP6 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GIMAP6

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase IMAP family member 6

Protein Size: 292

Purification: Affinity Purified

• Artikelnummer: AVIARP56178_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56178_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 474344
• Wirt: Rabbit