GK Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GK

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol kinase Ensembl ENSP00000368229

Protein Size: 530

Purification: Affinity Purified

• Artikelnummer: AVIARP55955_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55955_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2710
• Wirt: Rabbit