GLO1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLO1

Key Reference: Degaffe,G.H., (er) J. Diabetes Complicat. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lactoylglutathione lyase

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP54803_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54803_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2739
• Wirt: Rabbit