GLRX Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX

Key Reference: Prinarakis,E., (2008) EMBO J. 27 (6), 865-875

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-1

Protein Size: 106

Purification: Affinity Purified

• Artikelnummer: AVIARP54626_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54626_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2745
• Wirt: Rabbit