GLRX Antibody - N-terminal region : HRP

GLRX Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54626_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX

Key Reference: Prinarakis,E., (2008) EMBO J. 27 (6), 865-875

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-1

Protein Size: 106

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54626_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54626_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2745
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×