Glrx1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Glrx1 catalyzes the deglutathionylation of protein-SS-glutathione mixed disulfides.

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: QEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-1

Protein Size: 107

Purification: Affinity Purified

• Artikelnummer: AVIARP54625_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54625_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64045
• Wirt: Rabbit