Glrx1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glrx1 catalyzes the deglutathionylation of protein-SS-glutathione mixed disulfides.

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: QEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-1

Protein Size: 107

Purification: Affinity Purified

• Artikelnummer: AVIARP54625_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54625_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64045
• Wirt: Rabbit