English
GLRX3 Antibody - N-terminal region : Biotin
GLRX3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58626_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: GLRX3 may play a role in regulating the function of the thioredoxin system.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX3
Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Molecular Weight: 37kDa
Peptide Sequence: Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Glutaredoxin-3
Protein Size: 335
Purification: Affinity Purified
Description of Target: GLRX3 may play a role in regulating the function of the thioredoxin system.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX3
Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Molecular Weight: 37kDa
Peptide Sequence: Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Glutaredoxin-3
Protein Size: 335
Purification: Affinity Purified
| Artikelnummer | AVIARP58626_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58626_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10539 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
