GLRX5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX5

Key Reference: Camaschella,C., (2007) Blood 110 (4), 1353-1358

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-related protein 5, mitochondrial

Protein Size: 157

Purification: Affinity Purified

• Artikelnummer: AVIARP56908_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56908_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51218
• Wirt: Rabbit