GLUD2 Antibody - N-terminal region : HRP

GLUD2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54828_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutamate dehydrogenase 2, mitochondrial

Protein Size: 558

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54828_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54828_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2747
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×