GNA12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNA12

Key Reference: Jeske,Y.W., (2008) Clin. Exp. Pharmacol. Physiol. 35 (4), 380-385

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein subunit alpha-12

Protein Size: 381

Purification: Affinity Purified

Subunit: alpha-12

• Artikelnummer: AVIARP54813_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54813_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2768
• Wirt: Rabbit