GNA15 Antibody - N-terminal region : Biotin

GNA15 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58472_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNA15

Key Reference: Johansson,B.B., (2005) FEBS J. 272 (20), 5365-5377

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit alpha-15

Protein Size: 374

Purification: Affinity Purified

Subunit: alpha-15
Mehr Informationen
Artikelnummer AVIARP58472_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58472_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2769
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×