GNAI2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI2

Key Reference: Sullivan,K.A., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(i) subunit alpha-2

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha-2

• Artikelnummer: AVIARP54631_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54631_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2771
• Wirt: Rabbit