GNAL Antibody - C-terminal region : FITC

GNAL Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54634_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAL

Key Reference: Laurin,N., (2008) J Psychiatr Res 42 (2), 117-124

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(olf) subunit alpha

Protein Size: 458

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP54634_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54634_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2774
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×