GNAQ Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAQ

Key Reference: Zapf,J., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha

• Artikelnummer: AVIARP54635_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54635_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2776
• Wirt: Rabbit