GNAQ Antibody - N-terminal region : HRP

GNAQ Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54635_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAQ

Key Reference: Zapf,J., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP54635_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54635_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2776
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×