GNGT2 Antibody - middle region : Biotin

GNGT2 Antibody - middle region : Biotin
Artikelnummer
AVIARP55401_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNGT2

Key Reference: DePuy,S.D., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (39), 14590-14595

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Protein Size: 69

Purification: Affinity Purified

Subunit: gamma-T2
Mehr Informationen
Artikelnummer AVIARP55401_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55401_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2793
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×