GOLGA7 Antibody - N-terminal region : Biotin

GOLGA7 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56836_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGA7

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgin subfamily A member 7

Protein Size: 137

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56836_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56836_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51125
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×