English
GOPC Antibody - middle region : HRP
GOPC Antibody - middle region : HRP
Artikelnummer
AVIARP56215_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GOPC
Key Reference: Wolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein
Protein Size: 454
Purification: Affinity Purified
Description of Target: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GOPC
Key Reference: Wolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109
Molecular Weight: 50kDa
Peptide Sequence: Synthetic peptide located within the following region: RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein
Protein Size: 454
Purification: Affinity Purified
| Artikelnummer | AVIARP56215_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56215_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 57120 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
