GOPC Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOPC

Key Reference: Wolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein

Protein Size: 454

Purification: Affinity Purified

• Artikelnummer: AVIARP56214_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56214_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57120
• Wirt: Rabbit