GPATCH2 Antibody - N-terminal region : FITC

GPATCH2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57093_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse GPATCH2

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: G patch domain-containing protein 2

Protein Size: 400

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57093_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57093_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55105
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×