GPR83 Antibody - C-terminal region : Biotin

GPR83 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59122_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GPR83 is an orphan receptor. GPR83 could be a neuropeptide Y receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GPR83

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable G-protein coupled receptor 83

Protein Size: 423

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59122_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59122_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10888
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×