GRIPAP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIPAP1

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GRIP1-associated protein 1

Protein Size: 841

Purification: Affinity Purified

• Artikelnummer: AVIARP57358_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57358_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56850
• Wirt: Rabbit