GRIPAP1 Antibody - N-terminal region : FITC

GRIPAP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57358_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIPAP1

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GRIP1-associated protein 1

Protein Size: 841

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57358_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57358_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56850
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×