GSG1L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: As a component of the inner core of AMPAR complex, GSG1L modifies AMPA receptor (AMPAR) gating.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSG1L

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: NFHTGIWYSCEEELSGLGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 280

Purification: Affinity Purified

• Artikelnummer: AVIARP54557_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54557_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 146395
• Wirt: Rabbit