GSPT2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 BC036077.1 1-207 208-1527 AJ251548.1 12-1331 1528-2497 AK001303.1 1512-2481 2498-2503 AK023155.1 2487-2492

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSPT2

Key Reference: Chauvin,C., (2005) Mol. Cell. Biol. 25 (14), 5801-5811

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

Protein Size: 628

Purification: Affinity Purified

Subunit: ERF3B

• Artikelnummer: AVIARP55356_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55356_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23708
• Wirt: Rabbit