GSTK1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSTK1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione S-transferase kappa 1

Protein Size: 226

Purification: Affinity Purified

• Artikelnummer: AVIARP55335_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55335_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 373156
• Wirt: Rabbit