GSTK1 Antibody - N-terminal region : FITC

GSTK1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55334_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTK1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione S-transferase kappa 1

Protein Size: 226

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55334_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55334_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 373156
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×