GTF2A1 Antibody - middle region : Biotin

GTF2A1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58156_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTF2A1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 337

Purification: Affinity Purified

Subunit: 1
Mehr Informationen
Artikelnummer AVIARP58156_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58156_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2957
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×