Guf1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Guf1 promotes mitochondrial protein synthesis. It may act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. It binds to mitochondrial ribosomes in a GTP-dependent manner.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Translation factor Guf1, mitochondrial

Protein Size: 651

Purification: Affinity Purified

• Artikelnummer: AVIARP57564_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57564_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 231279
• Wirt: Rabbit