H2AFY Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Core histone macro-H2A.1

Protein Size: 369

Purification: Affinity Purified

• Artikelnummer: AVIARP58282_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58282_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9555
• Wirt: Rabbit