HADH Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HADH

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Protein Size: 314

Purification: Affinity Purified

• Artikelnummer: AVIARP54764_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54764_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3033
• Wirt: Rabbit