HDDC3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDDC3

Key Reference: Zody,M.C., (2006) Nature 440 (7084), 671-675

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

Protein Size: 140

Purification: Affinity Purified

• Artikelnummer: AVIARP55898_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55898_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 374659
• Wirt: Rabbit