HECA Antibody - middle region : FITC

HECA Antibody - middle region : FITC
Artikelnummer
AVIARP56855_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits termina

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HECA

Key Reference: 0

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Headcase protein homolog

Protein Size: 543

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56855_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56855_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51696
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×