HIST2H2BF Antibody - N-terminal region : HRP

HIST2H2BF Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56220_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF

Key Reference: Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone H2B type 2-F

Protein Size: 126

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56220_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56220_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 440689
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×