Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Applications: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Background: Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.
Description: Human Histone H1, also known as H1F0, (GenBank Accession No. NM_005318), a.a. 2-194(end) with N-terminal His-tag, MW = 21.7 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol
Genbank: NM_005318
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag
Uniprot: P07305
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Doenecke, D., et al., J. Mol.Biol. 1986
Feb 5;187(3):461-4.
2. Vyas, P., et al., J. Biol. Chem. 2012 Apr
6;287(15):11778-87.