HMBS Antibody - N-terminal region : HRP

HMBS Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54451_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBS

Key Reference: Kuo,H.C., J. Neurol. Sci. 260 (1-2), 231-235 (2007)

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Porphobilinogen deaminase

Protein Size: 344

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54451_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54451_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3145
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×