HOXB3 Antibody - middle region : Biotin

HOXB3 Antibody - middle region : Biotin
Artikelnummer
AVIARP58019_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HOXB3 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB3 gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXB3

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-B3

Protein Size: 431

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58019_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58019_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3213
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×