HOXC8 Antibody - middle region : Biotin

HOXC8 Antibody - middle region : Biotin
Artikelnummer
AVIARP57869_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Key Reference: Kikugawa,T., (2006) Prostate 66 (10), 1092-1099

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-C8

Protein Size: 242

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57869_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57869_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3224
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×