HSPA6 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA6

Key Reference: Noonan,E.J., (2007) Cell Stress Chaperones 12 (4), 393-402

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock 70 kDa protein 6

Protein Size: 643

Purification: Affinity Purified

• Artikelnummer: AVIARP54649_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54649_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3310
• Wirt: Rabbit