HTRA4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTRA4

Key Reference: Clausen,T., (2002) Mol. Cell 10 (3), 443-455

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine protease HTRA4

Protein Size: 476

Purification: Affinity Purified

• Artikelnummer: AVIARP55603_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55603_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 203100
• Wirt: Rabbit