Human beta Defensin-1 Recombinant

Human beta Defensin-1 Recombinant
Artikelnummer
BPS90106-A
Verpackungseinheit
5 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Background: Defensins are a large family of peptides of which two groups exist in mammals: alpha defensins and beta defensins, which are distinguishable by the spacing and connectivity of the conserved cysteine residues within the mature peptides. It is thought that defensins function in the eradication of pathogens from the host system by inserting themselves into the bacterial membrane under the influence of membrane potential, forming channels which lead to leakage of cytoplasmic molecules and cell death. Human beta-defensin-1, which has 36 amino acids, was originally isolated from hemofiltrates of patients with advanced renal failure. The BD-1 gene is expressed mainly in the urogenital tract and, to a lesser degree, in trachea and lung. BD-1 is believed to function in the antimicrobial defense of the urogenital and respiratory tracts.

Biological Activity: The ED50 was determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0 µg/ml.

Description: Recombinant beta Defensin-1 is a disulfide-linked monomer protein consisting of 47 amino acid residues, and migrates as an approximately 5 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human beta Defensin-1 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered 100 mM NaCl, 20 mM phosphate buffer, pH 7.4.

Genbank: P60022

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P60022

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Biol. Chem., Jan 2007, 282: 1819 - 1829.
2. Cancer Res., Sep 2006, 66: 8542 - 8549.
3. Infect. Immun., Apr 2006, 74: 2338 - 2352.
Mehr Informationen
Artikelnummer BPS90106-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90106-A
Green Labware Nein
Verpackungseinheit 5 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×